![Western Blot: CDR2L Antibody [NBP1-93681] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Western-Blot-NBP1-93681-img0008.jpg "Western Blot: CDR2L Antibody [NBP1-93681] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CDR2L Antibody - BSA Free (NBP1-93681) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CDR2L Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDR2L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDR2L |
![Immunocytochemistry/Immunofluorescence: CDR2L Antibody [NBP1-93681] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93681-img0009.jpg "Immunocytochemistry/Immunofluorescence: CDR2L Antibody [NBP1-93681] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human skeletal muscle shows very low positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Immunohistochemistry-Paraffin-NBP1-93681-img0016.jpg "Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human skeletal muscle shows very low positivity in myocytes as expected.")
![Western Blot: CDR2L Antibody [NBP1-93681] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Western-Blot-NBP1-93681-img0007.jpg "Western Blot: CDR2L Antibody [NBP1-93681] - Analysis in human cell line SK-BR-3.")
![Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Immunohistochemistry-Paraffin-NBP1-93681-img0014.jpg "Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Immunohistochemistry-Paraffin-NBP1-93681-img0015.jpg "Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CDR2L-Antibody-Immunohistochemistry-Paraffin-NBP1-93681-img0017.jpg "Immunohistochemistry-Paraffin: CDR2L Antibody [NBP1-93681] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")