CDKL1 Recombinant Protein Antigen

Images

 
There are currently no images for CDKL1 Protein (NBP2-32482PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDKL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDKL1.

Source: E.coli

Amino Acid Sequence: RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDKL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32482.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CDKL1 Recombinant Protein Antigen

  • CDC2-related kinase 1
  • cyclin-dependent kinase-like 1 (CDC2-related kinase)
  • cyclin-dependent kinase-like 1
  • EC 2.7.11
  • EC 2.7.11.22
  • KKIALRE
  • P42
  • Protein kinase p42 KKIALRE
  • serine/threonine protein kinase KKIALRE
  • Serine/threonine-protein kinase KKIALRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-97510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03903
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB4640
Species: Hu
Applications: WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32482PEP
Species: Hu
Applications: AC

Publications for CDKL1 Protein (NBP2-32482PEP) (0)

There are no publications for CDKL1 Protein (NBP2-32482PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL1 Protein (NBP2-32482PEP) (0)

There are no reviews for CDKL1 Protein (NBP2-32482PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDKL1 Protein (NBP2-32482PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CDKL1 Products

Bioinformatics Tool for CDKL1 Protein (NBP2-32482PEP)

Discover related pathways, diseases and genes to CDKL1 Protein (NBP2-32482PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL1 Protein (NBP2-32482PEP)

Discover more about diseases related to CDKL1 Protein (NBP2-32482PEP).
 

Pathways for CDKL1 Protein (NBP2-32482PEP)

View related products by pathway.

PTMs for CDKL1 Protein (NBP2-32482PEP)

Learn more about PTMs related to CDKL1 Protein (NBP2-32482PEP).
 

Research Areas for CDKL1 Protein (NBP2-32482PEP)

Find related products by research area.

Blogs on CDKL1

There are no specific blogs for CDKL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDKL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL1