CDK5 Activator 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CDK5 Activator 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK5 Activator 1.

  Source: E. coli

  Amino Acid Sequence: FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CDK5R1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55112.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDK5 Activator 1 Recombinant Protein Antigen

• CDK5 Activator 1
• CDK5P35
• CDK5R
• CDK5R1
• cyclin-dependent kinase 5 activator 1
• Cyclin-dependent kinase 5 regulatory subunit 1
• cyclin-dependent kinase 5, regulatory subunit 1 (p35)
• MGC33831
• NCK5A
• Neuronal CDK5 Activator
• p23
• p25
• p35
• p35nck5a
• regulatory partner for CDK5 kinase
• tau protein kinase II 23kDa subunit
• TPKII Regulatory Subunit

Background

The baculoviruses are a large, diverse family of DNA viruses that have evolved a number of mechanisms to manipulate thier insect hosts. One of these is the ability to regulate apoptosis during infection by expressing proteins that can inhibit caspase activation, including the caspase inhibitor p35 and the inhibitor of apoptosis (IAP) proteins (reviewed in Clem, 2005; Clarke and Clem, 2003; and Iller, 1997). The p35 baculovirus protein strongly inhibits caspase enzymatic activity, and is the the most broadly acting caspase inhibitor protein known. p35 baculovirus forms essentially irreversible complexes with its target caspases in a process that is accompanied by the cleavage of p35, generating two fragments of approximately 10 kDa and 25 kDa. These cleavage fragments remain associated with caspases and thereby block caspase activity. The ability of p35 to inhibit caspases along with the central role of caspases in the apoptotic process enables p35 baculovirus to block apoptosis in a phylogentically broad range of cells, and in response to a wide variety of apoptotic induction signals. For example, over expression of p35 in mammalian, insect, and nematode cells results in resistance to apoptosis. IMG-5740 recognizes p35 baculovirus; p35 baculovirus migrates at ~35 kDa on SDS-PAGE.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CDK5R1