Home » CDC73/HRPT2 » CDC73 Peptides and Proteins » CDC73/HRPT2 Recombinant Protein Antigen

CDC73/HRPT2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CDC73/HRPT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC73/HRPT2

Source: E.coli

Amino Acid Sequence: WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHL
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC73
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP3-17817. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC73/HRPT2 Recombinant Protein Antigen

  • C1orf28hyperparathyroidism 2 (with jaw tumor)
  • CDC73
  • cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S.cerevisiae)
  • Cell division cycle protein 73 homolog
  • chromosome 1 open reading frame 28
  • HPTJT
  • HPT-JT
  • HRPT2
  • HRPT2FLJ23316
  • Hyperparathyroidism 2 protein
  • HYX
  • Parafibromin

Background

Parafibromin, the product of gene HPRT2, acts as a tumor suppressor protein by inhibiting cell proliferation and blocking expression of cyclin D1 when overexpressed. Parafibromin has also been shown to bind with the PAF1 complex / RNA polymerase II which is involved with transcription elongation and the RNA processing pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PAF1 Antibody
NB600-273
Western Blot: PAF1 Antibody [NB600-273] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiPaf1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: PAF1 Antibody [NB600-273] - Detection of human Paf1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Paf1 antibody NB600-273 used for IP at 3 ug per reaction. Paf1 was also immunoprecipitated by rabbit anti-Paf1 antibody NB600-274. For blotting immunoprecipitated Paf1, NB600-273 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(5 Publications)
Species: Hu, Mu
Applications: IP, WB
PXMP3 Antibody
NBP2-94643
Western Blot: PXMP3 Antibody [NBP2-94643] - Analysis of extracts of various cell lines, using PXMP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 20s.
Immunohistochemistry-Paraffin: PXMP3 Antibody [NBP2-94643] - Immunohistochemistry of paraffin-embedded human placenta using PXMP3 Rabbit pAb (NBP2-94643) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Menin Antibody
NB100-215
Immunoprecipitation: Menin Antibody [NB100-215] - Detection of human Menin by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Menin antibody NB100-215 (lot 2) used for IP at 6 ug per reaction. Menin was also immunoprecipitated by a previous lot of this antibody (lot 1). For blotting immunoprecipitated Menin, NB100-215 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
Western Blot: Menin Antibody [NB100-215] - Whole cell lysate (50 ug) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Menin antibody used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Menin Antibody [NB100-215] - Whole cell lysate (50 ug) from TCMK-1 and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Menin antibody used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(26 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Total protein from human Hek293 and rat Pancreas was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CaSR in block buffer and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Immunocytochemistry/Immunofluorescence: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Analysis of primary astrocytes using Calcium-sensing R/CaSR antibody. Primary astrocytes co-stained with cilia (Arl13b, red, top left), CASR (green, bottom left), DAPI (blue, top right) and merged (bottom right). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Calcium-sensing R/CaSR Antibody (5C10, ADD) [NB120-19347] - Analysis of bovine corneal epithelium (CE) limbus tissue.
(1 Review)
(20 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(8 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
PTH was detected in immersion fixed paraffin-embedded sections of human parathyroid gland using Mouse Anti-Human PTH Monoclonal Antibody (Catalog # MAB7665) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human parathyroid tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PTH Monoclonal Antibody (Catalog # MAB7665) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PTH at approximately 12 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, WB
LEO1 Antibody
NB600-276
Immunohistochemistry: LEO1 Antibody [NB600-276] - Sample: FFPE section of human stomach carcinoma (left) and mouse teratoma (right). Antibody: Affinity purified rabbit anti-LEO1 used at a dilution of 1:5,000 (0.2ug/ml) and 1:1,000 (1ug/ml). Detection: DAB
Immunohistochemistry: LEO1 Antibody [NB600-276] - Detection of mouse Leo1 by immunohistochemistry. Sample: FFPE section of mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-Leo1 (NB600-276). Detection: DAB
Western Blot: LEO1 Antibody [NB600-276] - Detection of human Leo1 by western blot. Samples: Whole cell lysate (15 ug) from HeLa, MCF-7, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Leo1 antibody [NB600-276] used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
CTR9 Antibody
NB100-68205
Immunoprecipitation: CTR9 Antibody [NB100-68205] - Detection of human CTR9 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CTR9 antibody NB100-68205 (lot NB100-68205-4) used for IP at 6 ug per reaction. CTR9 was also immunoprecipitated by a previous lot of this antibody (lot NB100-68205-3). For blotting immunoprecipitated CTR9, NB100-68205 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: CTR9 Antibody [NB100-68205] - FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-CTR9 used at a dilution of 1:5,000 (0.2 ug/ml). Detection: DAB. Counterstain: Hematoxylin (blue).
Immunohistochemistry-Paraffin: CTR9 Antibody [NB100-68205] - FFPE section of human breast carcinoma. Affinity purified rabbit anti-CTR9 used at a dilution of 1:250.
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(29 Publications)
Species: Mu
Applications: IHC, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RTF1 Antibody
NB100-61052
Immunohistochemistry-Paraffin: RTF1 Antibody [NB100-61052] - Sample: FFPE section of human skin carcinoma (left) and mouse teratoma (right). Antibody: Affinity purified rabbit anti- RTF1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: RTF1 Antibody [NB100-61052] - Detection of Human RTF1 on HeLa whole cell lysate using NB100-61052. RTF1 was also immunoprecipitated by rabbit anti-RTF1 antibody NB600-178.
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
IFI27 Antibody
H00003429-A01
Western Blot: IFI27 Antibody [H00003429-A01] - Detection against Immunogen (39.2 KDa) .
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
TMED7 Antibody
NBP1-90949
Immunohistochemistry-Paraffin: TMED7 Antibody [NBP1-90949] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: TMED7 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
26S proteasome
subunit 9 Antibody
NBP2-47561
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney, liver, skin and testis using Anti-PSMD9 antibody NBP2-47561 (A) shows similar protein distribution across tissues to independent antibody NBP2-47560(B).
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human kidney using Anti-PSMD9 antibody.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47561] - Staining of human liver using Anti-PSMD9 antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dynactin 6 Antibody
NBP1-80616
Immunohistochemistry-Paraffin: Dynactin 6 Antibody [NBP1-80616] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SSSCA1 Antibody
(OTI2F5)
NBP2-03198
Flow Cytometry: SSSCA1 Antibody (OTI2F5) [NBP2-03198] - Analysis of Hela cells, using anti-SSSCA1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SSSCA1 Antibody (OTI2F5) [NBP2-03198] - Analysis of Jurkat cells, using anti-SSSCA1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SSSCA1 Antibody (OTI2F5) [NBP2-03198] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-SSSCA1 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP) (0)

There are no publications for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP) (0)

There are no reviews for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC73/HRPT2 Products

Bioinformatics Tool for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP)

Discover related pathways, diseases and genes to CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP)

Discover more about diseases related to CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP).
 

Pathways for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP)

View related products by pathway.

PTMs for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP)

Learn more about PTMs related to CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP).
 

Research Areas for CDC73/HRPT2 Recombinant Protein Antigen (NBP3-17817PEP)

Find related products by research area.

Blogs on CDC73/HRPT2

There are no specific blogs for CDC73/HRPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC73/HRPT2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDC73