CDC73/HRPT2 Recombinant Protein Antigen

Images

 
There are currently no images for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC73/HRPT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC73/HRPT2.

Source: E. coli

Amino Acid Sequence: ADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC73
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51197.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CDC73/HRPT2 Recombinant Protein Antigen

  • C1orf28hyperparathyroidism 2 (with jaw tumor)
  • CDC73
  • cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S.cerevisiae)
  • Cell division cycle protein 73 homolog
  • chromosome 1 open reading frame 28
  • HPTJT
  • HPT-JT
  • HRPT2
  • HRPT2FLJ23316
  • Hyperparathyroidism 2 protein
  • HYX
  • Parafibromin

Background

Parafibromin, the product of gene HPRT2, acts as a tumor suppressor protein by inhibiting cell proliferation and blocking expression of cyclin D1 when overexpressed. Parafibromin has also been shown to bind with the PAF1 complex / RNA polymerase II which is involved with transcription elongation and the RNA processing pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-273
Species: Hu, Mu
Applications: IP, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-215
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB7665
Species: Hu
Applications: IHC, WB
NB600-276
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-68205
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF482
Species: Mu
Applications: IHC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-61052
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF1555
Species: Hu
Applications: WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP) (0)

There are no publications for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP) (0)

There are no reviews for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC73/HRPT2 Products

Bioinformatics Tool for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP)

Discover related pathways, diseases and genes to CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP)

Discover more about diseases related to CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP).
 

Pathways for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP)

View related products by pathway.

PTMs for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP)

Learn more about PTMs related to CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP).
 

Research Areas for CDC73/HRPT2 Recombinant Protein Antigen (NBP2-55257PEP)

Find related products by research area.

Blogs on CDC73/HRPT2

There are no specific blogs for CDC73/HRPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC73/HRPT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC73