CDC5L Antibody

Product Discontinued

CDC5L Antibody Summary

• Immunogen: Synthetic peptides corresponding to CDC5L(CDC5 cell division cycle 5-like (S. pombe)) The peptide sequence was selected from the middle region of CDC5L. Peptide sequence LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Yeast (90%), Zebrafish (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC5L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against CDC5L and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CDC5L Antibody

• CDC5 (cell division cycle 5, S. pombe, homolog)-like
• CDC5 cell division cycle 5-like (S. pombe)
• CDC5
• Cdc5-like protein
• Cdc5-related protein
• CEF1
• cell division cycle 5-like protein
• dJ319D22.1 (CDC5-like protein)
• dJ319D22.1
• hCDC5
• KIAA0432
• PCDC5RPCDC5-LIKE
• Pombe cdc5-related protein

Background

CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC5L
• Uniprot:
  • Q99459(Human)