CDC42EP2 Antibody - Azide and BSA Free

Western Blot: CDC42EP2 Antibody [H00010435-D01P] - Analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 polyclonal antibody.Lane 1: CDC42EP2 transfected lysate(22.50 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CDC42EP2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit CDC42EP2 Antibody - Azide and BSA Free (H00010435-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CDC42EP2 (NP_006770.1, 1 a.a. - 210 a.a.) full-length human protein. MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC42EP2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC42EP2 Antibody - Azide and BSA Free

• BORG1CEP2Binder of Rho GTPases 1
• CDC42 effector protein (Rho GTPase binding) 2
• cdc42 effector protein 2
• CRIB-containing BOGR1 protein

Background

CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. Coexpression of this protein with dominant negative mutant CDC42 protein in fibroblast was found to induce pseudopodia formation, which suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC42EP2
• Uniprot:
  • NP_006770.1(Human)