We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cdc20 Recombinant Protein Antigen

Images

 
There are currently no images for Cdc20 Protein (NBP2-38750PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cdc20 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC20.

Source: E. coli

Amino Acid Sequence: TPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38750.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cdc20 Recombinant Protein Antigen

  • CDC20 cell division cycle 20 homolog (S. cerevisiae)
  • CDC20 cell division cycle 20 homolog
  • Cdc20
  • cell division cycle 20 homolog (S. cerevisiae)
  • cell division cycle protein 20 homolog
  • MGC102824
  • p55CDC
  • p55CDCS. cerevisiae, homolog)

Background

CDC20 is a WD repeat containing cell cycle-regulator that binds to and activates the ubiquitin-ligase activity of the APC/c (anaphase-promoting complex/cyclosome). APC/c ubiquitinating activity is responsible for the degradation of securin and cyclin B that prompts the onset of anaphase and exit from mitosis. CDC20 has also been reported to form a complex with histone deacetylases and can function as a transcriptional repressor involved in cell cycle arrest. As a regulator of APC/c activity, CDC20 plays a key role in the spindle-assembly checkpoint.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
AF4185
Species: Hu
Applications: ICC
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP2-20287
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32775
Species: Hu, Mar, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89979
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP1-81765
Species: Hu
Applications: IHC,  IHC-P
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-89095
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-38750PEP
Species: Hu
Applications: AC

Publications for Cdc20 Protein (NBP2-38750PEP) (0)

There are no publications for Cdc20 Protein (NBP2-38750PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc20 Protein (NBP2-38750PEP) (0)

There are no reviews for Cdc20 Protein (NBP2-38750PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cdc20 Protein (NBP2-38750PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cdc20 Products

Research Areas for Cdc20 Protein (NBP2-38750PEP)

Find related products by research area.

Blogs on Cdc20

There are no specific blogs for Cdc20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cdc20 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC20