Cdc20 Antibody

Images

 
Western Blot: Cdc20 Antibody [H00000991-D01P] - Analysis of CDC20 expression in transfected 293T cell line by CDC20 polyclonal antibody.Lane 1: CDC20 transfected lysate(54.80 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Cdc20 Antibody [H00000991-D01P] - Analysis of protein-protein interactions between CDC20 and ANAPC11. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-ANAPC11 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdc20 Antibody Summary

Immunogen
CDC20 (AAH00624.1, 1 a.a. - 499 a.a.) full-length human protein. MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWVLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
Specificity
CDC20 - cell division cycle 20 homolog (S. cerevisiae),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC20
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdc20 Antibody

  • CDC20 cell division cycle 20 homolog (S. cerevisiae)
  • CDC20 cell division cycle 20 homolog
  • cell division cycle 20 homolog (S. cerevisiae)
  • cell division cycle protein 20 homolog
  • MGC102824
  • p55CDCS. cerevisiae, homolog)

Background

CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF4185
Species: Hu
Applications: ICC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000991-D01P
Species: Hu
Applications: WB, PLA

Publications for Cdc20 Antibody (H00000991-D01P) (0)

There are no publications for Cdc20 Antibody (H00000991-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdc20 Antibody (H00000991-D01P) (0)

There are no reviews for Cdc20 Antibody (H00000991-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdc20 Antibody (H00000991-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdc20 Products

Bioinformatics Tool for Cdc20 Antibody (H00000991-D01P)

Discover related pathways, diseases and genes to Cdc20 Antibody (H00000991-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc20 Antibody (H00000991-D01P)

Discover more about diseases related to Cdc20 Antibody (H00000991-D01P).
 

Pathways for Cdc20 Antibody (H00000991-D01P)

View related products by pathway.

PTMs for Cdc20 Antibody (H00000991-D01P)

Learn more about PTMs related to Cdc20 Antibody (H00000991-D01P).
 

Research Areas for Cdc20 Antibody (H00000991-D01P)

Find related products by research area.

Blogs on Cdc20

There are no specific blogs for Cdc20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdc20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC20
Entrez
Uniprot