CD99-L2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD99-L2 Antibody [NBP1-85738] - Staining in human cerebral cortex and tonsil tissues using anti-CD99L2 antibody. Corresponding CD99L2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD99-L2 Antibody [NBP1-85738] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: CD99-L2 Antibody [NBP1-85738] - Staining of human tonsil shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD99-L2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD99-L2 Antibody - BSA Free (NBP1-85738) is a polyclonal antibody validated for use in IHC. Anti-CD99-L2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD99L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD99-L2 Protein (NBP1-85738PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD99-L2 Antibody - BSA Free

• CD99 antigen
• CD99 antigen-like 2
• CD99 antigen-like protein 2
• CD99 molecule-like 2
• CD99B
• CD99L2
• CD99-L2
• DKFZp761H2024
• MIC2 like 1
• MIC2L1
• MIC2-like protein 1

Background

CD99L2 may function as a homophilic adhesion molecule. Functions in leukocyte-endothelial cell interactions duringleukocyte extravasation, and in particular, at the diapedesis step. Does not seem to be involved in docking ofleukocytes to the vessel wall or in ly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD99-L2 Antibody (NBP1-85738)(1)

Publication using NBP1-85738

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: CD99L2