CD99-L2 Antibody - BSA Free

Western Blot: CD99L2 Antibody [NBP1-79854] - PANC1 Cell Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CD99-L2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human CD99L2The immunogen for this antibody is CD99L2. Peptide sequence RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD99L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CD99-L2 Antibody - BSA Free

• CD99 antigen
• CD99 antigen-like 2
• CD99 antigen-like protein 2
• CD99 molecule-like 2
• CD99B
• CD99L2
• CD99-L2
• DKFZp761H2024
• MIC2 like 1
• MIC2L1
• MIC2-like protein 1

Background

CD99L2 may function as a homophilic adhesion molecule. Functions in leukocyte-endothelial cell interactions duringleukocyte extravasation, and in particular, at the diapedesis step. Does not seem to be involved in docking ofleukocytes to the vessel wall or in ly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD99L2
• Uniprot:
  • NP_604395(Human)