CD97 Antibody - BSA Free

Analysis in human lymph node and skeletal muscle tissues Corresponding ADGRE5 RNA-seq data are presented for the same tissues.

Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Staining of human placenta shows strong positivity in microvilli in trophoblastic cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD97 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD97 Antibody - BSA Free (NBP1-86935) is a polyclonal antibody validated for use in IHC and WB. Anti-CD97 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADGRE5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 24949957). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD97 Protein (NBP1-86935PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24949957).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD97 Antibody - BSA Free

• CD97 antigenseven-span transmembrane protein
• CD97 molecule
• Leukocyte antigen CD97
• seven transmembrane helix receptor
• seven-transmembrane, heterodimeric receptor associated with inflammation
• TM7LN1

Background

CD97, a CD55 Receptor, is a leukocyte antigen located on most activated leukocytes. CD97 is highly homologous to EMR2 with five EGF-like domains in the N-terminal extracellular domain, suggesting that it may be involved in cell signaling as well as in cell adhesion (Hamann et al., 1996). Two variants are produced by alternative splicing, where the shorter form lacks exons 5 and 6 and reduces the number of EGF-like domains from 5 to 3, compared to the full-length isoform. CD97 is associated with with the activated lesions of multiple sclerosis. CD97 expression is also implicated in the dedifferentiation of colon and thyroid tumors. CD97 is expressed abundantly in cells of hematopoietic origin and is markedly upregulated on activated T and B cells. ESTs have been isolated from a wide variety of tissue libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD97 Antibody (NBP1-86935)(1)

Publication using NBP1-86935

• Zyryanova T, Schneider R, Adams V et al. Skeletal Muscle Expression of the Adhesion-GPCR CD97: CD97 Deletion Induces an Abnormal Structure of the Sarcoplasmatic Reticulum but Does Not Impair Skeletal Muscle Function. PLoS One 2014-01-01 [PMID: 24949957] (WB, Mouse)

Bioinformatics

• Gene Symbol: ADGRE5