CD79B Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CD79B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD79B Antibody - BSA Free
Background
Murine CD79 is a 23/21 kDa disulfide-linked heterodimer composed of an alpha chain (CD79alpha/mb-1) and a beta chain (CD79b/B29) that associates non-covalently with membrane immunoglobulin (Ig) to form the B cell receptor (BCR) complex. Its expression is restricted to B lymphocytes, first appearing on the surface at the pro-B cell stage prior to productive Ig gene rearrangements and remaining through all stages of B-cell differentiation prior to plasma cells. It has been proposed that the CD79 complex on pro-B cell surfaces may function to induce early B-cell differentiation. (1)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: Bind
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Mu
Applications: CyTOF-ready, Flow, Simple Western, WB
Publications for CD79B Antibody (NBP3-21270) (0)
There are no publications for CD79B Antibody (NBP3-21270).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD79B Antibody (NBP3-21270) (0)
There are no reviews for CD79B Antibody (NBP3-21270).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CD79B Antibody (NBP3-21270) (0)