CD79B Antibody - BSA Free

Western Blot: CD79B Antibody [NBP1-88945] - Analysis in control (vector only transfected HEK293T lysate) and CD79B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: CD79B Antibody [NBP1-88945] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945] - Staining in human lymph node and cerebral cortex tissues using anti-CD79B antibody. Corresponding CD79B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra and weak to moderate in reaction center cells.

Immunohistochemistry-Paraffin: CD79B Antibody [NBP1-88945] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD79B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD79B Antibody - BSA Free (NBP1-88945) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Predicted Species: Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD79B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CD79B Protein (NBP1-88945PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD79B Antibody - BSA Free

• B29
• B29B-cell-specific glycoprotein B29
• B-cell antigen receptor complex-associated protein beta chain
• CD79B antigen (immunoglobulin-associated beta)
• CD79b antigen
• CD79b molecule, immunoglobulin-associated beta
• CD79B
• IGB
• IGBAGM6
• Ig-beta
• Immunoglobulin-associated B29 protein

Background

Murine CD79 is a 23/21 kDa disulfide-linked heterodimer composed of an alpha chain (CD79alpha/mb-1) and a beta chain (CD79b/B29) that associates non-covalently with membrane immunoglobulin (Ig) to form the B cell receptor (BCR) complex. Its expression is restricted to B lymphocytes, first appearing on the surface at the pro-B cell stage prior to productive Ig gene rearrangements and remaining through all stages of B-cell differentiation prior to plasma cells. It has been proposed that the CD79 complex on pro-B cell surfaces may function to induce early B-cell differentiation. (1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD79B