| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
| Predicted Species | Mouse (96%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD79B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD79B Antibody (NBP1-88945)Find related products by research area.
|
|
CD79b - A Signal Transduction Component of the B-cell Receptor The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD79B |