We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CD79A Recombinant Protein Antigen

Images

 
There are currently no images for CD79A Recombinant Protein Antigen (NBP3-24725PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD79A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD79A

Source: E.coli

Amino Acid Sequence: ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD79A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24725It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD79A Recombinant Protein Antigen

  • CD79A antigen (immunoglobulin-associated alpha)
  • CD79a antigen
  • CD79a molecule, immunoglobulin-associated alpha
  • CD79A
  • IGAB-cell antigen receptor complex-associated protein alpha chain
  • ig-alpha
  • MB-1 membrane glycoprotein
  • MB1
  • MB-1
  • Membrane-bound immunoglobulin-associated protein
  • Surface IgM-associated protein

Background

CD79a is a disulphide-linked heterodimer, consisting of mb-1 (or CD79a) and B29 (or CD79b) polypeptides, is non-covalently associated with membrane-bound immunoglobulins on B cells to constitute the B cell Ag receptor. CD79a first appears at pre B cell stage and persists until the plasma cell stage where it is found as an intracellular component. CD79a is found in the majority of acute leukemias of precursor B cell type, in B cell lines, B cell lymphomas, and in some myelomas. It is not present in myeloid or T cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF6814
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-61707
Species: Hu
Applications: ELISA, Flow, WB
NBP2-13608
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-46157
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP3-07581
Species: Ca, Eq, Fe, Hu, RM
Applications: IHC-Fr,  IHC-P, PA, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-62227
Species: Hu
Applications: Flow, Func, IHC,  IHC-P, IP, WB
NB100-64980
Species: Hu
Applications: Flow, Func, IHC, IHC-Fr,  IHC-P, WB
NBP2-46125
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for CD79A Recombinant Protein Antigen (NBP3-24725PEP) (0)

There are no publications for CD79A Recombinant Protein Antigen (NBP3-24725PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD79A Recombinant Protein Antigen (NBP3-24725PEP) (0)

There are no reviews for CD79A Recombinant Protein Antigen (NBP3-24725PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD79A Recombinant Protein Antigen (NBP3-24725PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD79A Products

Research Areas for CD79A Recombinant Protein Antigen (NBP3-24725PEP)

Find related products by research area.

Blogs on CD79A.

CD79b - A Signal Transduction Component of the B-cell Receptor
The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD79A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD79A