CD300c/LMIR2 Antibody

Images

 
Western Blot: CD300C Antibody [NBP1-84432] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: CD300C Antibody [NBP1-84432] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD300c/LMIR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD300C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD300c/LMIR2 Protein (NBP1-84432PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD300c/LMIR2 Antibody

  • CD300c antigenCMRF35 antigen
  • CD300c molecule
  • CD300c
  • CLM6
  • CLM-6
  • CMRF35 leukocyte immunoglobulin-like receptor
  • CMRF-35
  • CMRF35A leukocyte immunoglobulin-like receptor
  • CMRF-35A
  • CMRF35ACMRF35A1
  • CMRF35CMRF35-A1
  • CMRF35-like molecule 6
  • DIgR1
  • IGSF16
  • IGSF16CD300 antigen-like family member C
  • IGSF7
  • Immunoglobulin superfamily member 16
  • LIR
  • LMIR2
  • MAIR-II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB20172
Species: Hu
Applications: WB, CyTOF-reported, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB2640
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
MAB2078
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
MAB27881
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6364
Species: Hu
Applications: Flow, CyTOF-ready
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-71703
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for CD300c/LMIR2 Antibody (NBP1-84432) (0)

There are no publications for CD300c/LMIR2 Antibody (NBP1-84432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300c/LMIR2 Antibody (NBP1-84432) (0)

There are no reviews for CD300c/LMIR2 Antibody (NBP1-84432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD300c/LMIR2 Antibody (NBP1-84432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD300c/LMIR2 Products

Bioinformatics Tool for CD300c/LMIR2 Antibody (NBP1-84432)

Discover related pathways, diseases and genes to CD300c/LMIR2 Antibody (NBP1-84432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD300c/LMIR2 Antibody (NBP1-84432)

Discover more about diseases related to CD300c/LMIR2 Antibody (NBP1-84432).
 

Pathways for CD300c/LMIR2 Antibody (NBP1-84432)

View related products by pathway.

PTMs for CD300c/LMIR2 Antibody (NBP1-84432)

Learn more about PTMs related to CD300c/LMIR2 Antibody (NBP1-84432).

Blogs on CD300c/LMIR2

There are no specific blogs for CD300c/LMIR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD300c/LMIR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD300C
Entrez