CD300a/LMIR1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CD300A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD300a/LMIR1 Antibody - BSA Free
Background
Human CD300a, otherwise known as IRp60 (inhibitory receptor protein 60), is a 60kDa transmembrane glycoprotein expressed by natural killer cells (NK), T and B cell subsets, monocytes, neutrophils, macrophages, granulocytes, dendritic cells (DC) and mast cells. Studies have shown that the cross-linking of CD300a on NK results in a down-regulation of their cytolytic activity, whilst cross-linking of CD300a on mast cells, inhibits IgE-induced degranulation and SCF-mediated survival. Furthermore, cross-linking of CD300a on the surface of eosinophils has been shown to significantly inhibit their survival, chemotaxis and activation in response to certain inflammatory cytokines, whilst eosinophil-derived MBP (major basic protein) and EDN (neurotoxin), can down-regulate CD300a expression on mast cells in vitro.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: IHC
Publications for CD300a/LMIR1 Antibody (NBP1-84431) (0)
There are no publications for CD300a/LMIR1 Antibody (NBP1-84431).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD300a/LMIR1 Antibody (NBP1-84431) (0)
There are no reviews for CD300a/LMIR1 Antibody (NBP1-84431).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CD300a/LMIR1 Antibody (NBP1-84431) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD300a/LMIR1 Products
Research Areas for CD300a/LMIR1 Antibody (NBP1-84431)
Find related products by research area.
|
Blogs on CD300a/LMIR1