We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CD27 Ligand/TNFSF7/CD70 Peptides and Proteins

Order Details


    • Catalog Number
      H00000970-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-193 of Human CD70 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CD70
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
46.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein

  • CD27 Ligand
  • CD27-L
  • CD27LCD27 ligand
  • CD27LG
  • CD70 molecule
  • CD70
  • Ki-24 antigen
  • surface antigen CD70
  • TNFSF7
  • TNFSF7CD70 antigen
  • tumor necrosis factor (ligand) superfamily, member 7
  • Tumor necrosis factor ligand superfamily member 7

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. TNFSF7( AAH00725, 1 a.a. - 194 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53196
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
DCDL40
Species: Hu
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1028
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
6507-IL/CF
Species: Hu
Applications: BA
AF1246
Species: Mu
Applications: WB
MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-62202
Species: Hu, Pm
Applications: ELISA, Flow, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-92684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
485-MI
Species: Mu
Applications: BA
DY417
Species: Mu
Applications: ELISA
MAB342
Species: Hu
Applications: AgAct, ICC, WB

Publications for CD27 Ligand/TNFSF7/CD70 Recombinant Protein (H00000970-P01) (0)

There are no publications for CD27 Ligand/TNFSF7/CD70 Recombinant Protein (H00000970-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD27 Ligand/TNFSF7/CD70 Recombinant Protein (H00000970-P01) (0)

There are no reviews for CD27 Ligand/TNFSF7/CD70 Recombinant Protein (H00000970-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD27 Ligand/TNFSF7/CD70 Recombinant Protein (H00000970-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD27 Ligand/TNFSF7/CD70 Products

Research Areas for CD27 Ligand/TNFSF7/CD70 Recombinant Protein (H00000970-P01)

Find related products by research area.

Blogs on CD27 Ligand/TNFSF7/CD70

There are no specific blogs for CD27 Ligand/TNFSF7/CD70, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD27 Ligand/TNFSF7/CD70 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD70