CCZ1 Antibody - BSA Free

Western Blot: CCZ1 Antibody [NBP2-46780] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma, Lane 5: Human Analysis of human liver tissue., Lane 6: Human Tonsil tissue

Immunocytochemistry/Immunofluorescence: CCZ1 Antibody [NBP2-46780] - Staining of human cell line HeLa shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CCZ1 Antibody [NBP2-46780] - Staining of human cerebellum shows no positivity as expected.

Immunohistochemistry-Paraffin: CCZ1 Antibody [NBP2-46780] - Staining of human cervix shows strong granular cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: CCZ1 Antibody [NBP2-46780] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: CCZ1 Antibody [NBP2-46780] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCZ1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCZ1 Antibody - BSA Free (NBP2-46780) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCZ1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CCZ1 Recombinant Protein Antigen (NBP2-46780PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCZ1 Antibody - BSA Free

• C7orf28A
• C7orf28B
• CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae)
• CCZ1 vacuolar protein trafficking and biogenesis associated homolog B (S. cerevisiae)
• CCZ1A
• CGI-43
• chromosome 7 open reading frame 28B
• FLJ60592
• H_DJ1163J12.2
• H_NH0577018.2
• MGC19819
• vacuolar fusion protein CCZ1 homolog-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCZ1
• Entrez:
  • 51622(Human)
• Uniprot:
  • P86791(Human)