CCNL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCNL1 Antibody [NBP2-58232] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCNL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRS
Specificity
Specificity of human CCNL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCNL1 Recombinant Protein Antigen (NBP2-58232PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCNL1 Antibody

  • ANIA6A
  • ania-6a
  • cyclin L ania-6a
  • cyclin L gamma
  • cyclin L1
  • cyclin-L
  • cyclin-L1
  • PRO1073

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47497
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-87011
Species: Hu
Applications: WB, IP
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
H00000111-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, S-ELISA
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NB100-496
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NBP1-93995
Species: Hu
Applications: IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-92609
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85943
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92826
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-58232
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for CCNL1 Antibody (NBP2-58232) (0)

There are no publications for CCNL1 Antibody (NBP2-58232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCNL1 Antibody (NBP2-58232) (0)

There are no reviews for CCNL1 Antibody (NBP2-58232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCNL1 Antibody (NBP2-58232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCNL1 Products

Bioinformatics Tool for CCNL1 Antibody (NBP2-58232)

Discover related pathways, diseases and genes to CCNL1 Antibody (NBP2-58232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCNL1 Antibody (NBP2-58232)

Discover more about diseases related to CCNL1 Antibody (NBP2-58232).
 

Pathways for CCNL1 Antibody (NBP2-58232)

View related products by pathway.

PTMs for CCNL1 Antibody (NBP2-58232)

Learn more about PTMs related to CCNL1 Antibody (NBP2-58232).

Blogs on CCNL1

There are no specific blogs for CCNL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCNL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNL1