Recombinant Human CCNDBP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CCNDBP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 261-360 of Human CCNDBP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LVAENGKKDQVAQMADIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CCNDBP1

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCNDBP1 Protein

  • cyclin D-type binding-protein 1
  • cyclin-D1-binding protein 1
  • DIP1HHM Protein
  • D-type cyclin-interacting protein 1
  • GCIPgrap2 cyclin interacting protein
  • Grap2 and cyclin-D-interacting protein
  • HHM
  • Human homolog of Maid
  • MAID protein

Background

This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Two alternatively spliced variants, which encode distinct isoforms, have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00002978-R01V
Species: Hu
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023582-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CCNDBP1 Partial Recombinant Protein (H00023582-Q01) (0)

There are no publications for CCNDBP1 Partial Recombinant Protein (H00023582-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCNDBP1 Partial Recombinant Protein (H00023582-Q01) (0)

There are no reviews for CCNDBP1 Partial Recombinant Protein (H00023582-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCNDBP1 Partial Recombinant Protein (H00023582-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCNDBP1 Products

Bioinformatics Tool for CCNDBP1 Partial Recombinant Protein (H00023582-Q01)

Discover related pathways, diseases and genes to CCNDBP1 Partial Recombinant Protein (H00023582-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCNDBP1 Partial Recombinant Protein (H00023582-Q01)

Discover more about diseases related to CCNDBP1 Partial Recombinant Protein (H00023582-Q01).
 

Pathways for CCNDBP1 Partial Recombinant Protein (H00023582-Q01)

View related products by pathway.

PTMs for CCNDBP1 Partial Recombinant Protein (H00023582-Q01)

Learn more about PTMs related to CCNDBP1 Partial Recombinant Protein (H00023582-Q01).

Blogs on CCNDBP1

There are no specific blogs for CCNDBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CCNDBP1 Antibody
NBP2-58940

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCNDBP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNDBP1