CCNB3 Antibody

Images

 
Western Blot: CCNB3 Antibody [H00085417-D01P] - Analysis of CCNB3 expression in transfected 293T cell line by CCNB3 polyclonal antibody.Lane 1: CCNB3 transfected lysate(12.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCNB3 Antibody Summary

Immunogen
CCNB3 (ENSP00000365204, 1 a.a. - 111 a.a.) full-length human protein. MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKRSAFEDLTNASQCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLK
Specificity
CCNB3,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCNB3 Antibody

  • CYCB3
  • cyclin B3
  • G2/mitotic-specific cyclin-B3

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67749
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-87005
Species: Hu
Applications: WB, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-79749
Species: Hu
Applications: WB
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47801
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00085417-D01P
Species: Hu
Applications: WB

Publications for CCNB3 Antibody (H00085417-D01P) (0)

There are no publications for CCNB3 Antibody (H00085417-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCNB3 Antibody (H00085417-D01P) (0)

There are no reviews for CCNB3 Antibody (H00085417-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCNB3 Antibody (H00085417-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCNB3 Products

Bioinformatics Tool for CCNB3 Antibody (H00085417-D01P)

Discover related pathways, diseases and genes to CCNB3 Antibody (H00085417-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCNB3 Antibody (H00085417-D01P)

Discover more about diseases related to CCNB3 Antibody (H00085417-D01P).
 

Pathways for CCNB3 Antibody (H00085417-D01P)

View related products by pathway.

Research Areas for CCNB3 Antibody (H00085417-D01P)

Find related products by research area.

Blogs on CCNB3

There are no specific blogs for CCNB3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCNB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNB3
Entrez
Uniprot