CCM2 Antibody

Images

 
Western Blot: CCM2 Antibody [H00083605-D01P] - Analysis of CCM2 expression in transfected 293T cell line by CCM2 polyclonal antibody.Lane 1: CCM2 transfected lysate(48.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCM2 Antibody Summary

Immunogen
CCM2 (NP_113631.1, 1 a.a. ~ 444 a.a) full-length human protein.
Localization
MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLP ERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAKRAHQ LPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAA HLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAA ESKVAAEELCCLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDD SSTKVDIKETYEVEASTFCFPESVDVGGASPHSKTISESELSASATELLQ DYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTT NGNRATGSSDDRSAPSEGDEWDRMISDISSDIEALGCSMDQDSA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This product is used in Western Blot

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCM2 Antibody

  • C7orf22OSM
  • cerebral cavernous malformation 2
  • Cerebral cavernous malformations 2 protein
  • chromosome 7 open reading frame 22
  • malcavernin
  • MGC4067
  • MGC4607
  • MGC74868

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
557-NT/CF
Species: Rt
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF662
Species: Mu
Applications: WB, IHC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow

Publications for CCM2 Antibody (H00083605-D01P) (0)

There are no publications for CCM2 Antibody (H00083605-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCM2 Antibody (H00083605-D01P) (0)

There are no reviews for CCM2 Antibody (H00083605-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCM2 Antibody (H00083605-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCM2 Products

Bioinformatics Tool for CCM2 Antibody (H00083605-D01P)

Discover related pathways, diseases and genes to CCM2 Antibody (H00083605-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCM2 Antibody (H00083605-D01P)

Discover more about diseases related to CCM2 Antibody (H00083605-D01P).
 

Pathways for CCM2 Antibody (H00083605-D01P)

View related products by pathway.

PTMs for CCM2 Antibody (H00083605-D01P)

Learn more about PTMs related to CCM2 Antibody (H00083605-D01P).

Blogs on CCM2

There are no specific blogs for CCM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCM2