CCDC92 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC92 Antibody [NBP2-56862] - Staining of human cell line MCF7 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC92 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCTDLTYELTVKSSEQTGDGTSKSSELK
Specificity
Specificity of human CCDC92 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC92
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC92 Recombinant Protein Antigen (NBP2-56862PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCDC92 Antibody

  • coiled-coil domain containing 92
  • coiled-coil domain-containing protein 92
  • FLJ22471
  • limkain beta 2
  • Limkain beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81898
Species: Hu
Applications: IHC, IHC-P
NBP2-93726
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19860
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5236
Species: Mu
Applications: WB
NBP1-80141
Species: Hu
Applications: WB
NB400-111
Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-85886
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP3-04922
Species: Hu
Applications: WB, ICC/IF
NBP1-87097
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-77072
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-87459
Species: Hu
Applications: WB, IHC, IHC-P
NB600-609
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92428
Species: Hu
Applications: WB, ICC/IF
NBP2-56862
Species: Hu
Applications: ICC/IF

Publications for CCDC92 Antibody (NBP2-56862) (0)

There are no publications for CCDC92 Antibody (NBP2-56862).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC92 Antibody (NBP2-56862) (0)

There are no reviews for CCDC92 Antibody (NBP2-56862). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC92 Antibody (NBP2-56862) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCDC92 Products

Bioinformatics Tool for CCDC92 Antibody (NBP2-56862)

Discover related pathways, diseases and genes to CCDC92 Antibody (NBP2-56862). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC92 Antibody (NBP2-56862)

Discover more about diseases related to CCDC92 Antibody (NBP2-56862).

Blogs on CCDC92

There are no specific blogs for CCDC92, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC92 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC92