Recombinant Human CBS Protein

Images

 
SDS-Page: Recombinant Human CBS Protein [H00000875-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CBS Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CBS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CBS
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CBS Protein

  • cystathionine-beta-synthase
  • EC 4.2.1.2210Beta-thionase

Background

CBS - cystathionine-beta-synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for CBS Partial Recombinant Protein (H00000875-Q01) (0)

There are no publications for CBS Partial Recombinant Protein (H00000875-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBS Partial Recombinant Protein (H00000875-Q01) (0)

There are no reviews for CBS Partial Recombinant Protein (H00000875-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBS Partial Recombinant Protein (H00000875-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBS Products

Bioinformatics Tool for CBS Partial Recombinant Protein (H00000875-Q01)

Discover related pathways, diseases and genes to CBS Partial Recombinant Protein (H00000875-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBS Partial Recombinant Protein (H00000875-Q01)

Discover more about diseases related to CBS Partial Recombinant Protein (H00000875-Q01).
 

Pathways for CBS Partial Recombinant Protein (H00000875-Q01)

View related products by pathway.

PTMs for CBS Partial Recombinant Protein (H00000875-Q01)

Learn more about PTMs related to CBS Partial Recombinant Protein (H00000875-Q01).
 

Research Areas for CBS Partial Recombinant Protein (H00000875-Q01)

Find related products by research area.

Blogs on CBS

There are no specific blogs for CBS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CBS Antibody (3E1.)
H00000875-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CBS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CBS