CBS Antibody

Western Blot: CBS Antibody [H00000875-D01P] - Analysis of CBS expression in mouse kidney.

Western Blot: CBS Antibody [H00000875-D01P] - Analysis of CBS expression in human pancreas.

Western Blot: CBS Antibody [H00000875-D01P] - Analysis of CBS expression in transfected 293T cell line by CBS polyclonal antibody.Lane 1: CBS transfected lysate(60.60 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

CBS Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CBS (NP_000062.1, 1 a.a. - 551 a.a.) full-length human protein. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
• Specificity: CBS - cystathionine-beta-synthase,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBS
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBS Antibody

• cystathionine-beta-synthase
• EC 4.2.1.2210Beta-thionase

Background

The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CBS Antibody (H00000875-D01P)(8)

Publications using H00000875-D01P

• Donovan J, Wong PS, Garle MJ et al. Coronary artery hypoxic vasorelaxation is augmented by perivascular adipose tissue through a mechanism involving hydrogen sulfide and cystathionine-?-synthase. Acta Physiol (Oxf) 2018-06-13 [PMID: 29896909]
• Wang HJ, Xu X, Xie RH et al. Prenatal maternal stress induces visceral hypersensitivity of adult rat offspring through activation of cystathionine-?-synthase signaling in primary sensory neurons. Mol Pain 2018-04-30 [PMID: 29712513]
• Lee J, Sil Kang E, Kobayashi S et al. The viability of primary hepatocytes is maintained under a low cysteine-glutathione redox state with a marked elevation in ophthalmic acid production. Exp Cell Res 2017-10-26 [PMID: 29079265]
• Kobayashi S, Lee J, Takao T, Fujii J et al. Increased ophthalmic acid production is supported by amino acid catabolism under fasting conditions in mice. Biochem Biophys Res Commun 2017-07-27 [PMID: 28757411]
• Jiang P, Xu Z, Xiao B et al. Hydrogen sulfide protects against the development of experimental cerebral malaria in a C57BL/6 mouse model. Mol Med Rep 2017-06-23 [PMID: 28656241]
• Kurahashi T, Lee J, Nabeshima A et al. Ascorbic acid prevents acetaminophen-induced hepatotoxicity in mice by ameliorating glutathione recovery and autophagy. Arch Biochem Biophys 2016-08-15 [PMID: 27288086]
• Asimakopoulou A, Panopoulos P, Chasapis CT et al. Selectivity of commonly used pharmacological inhibitors for cystathionine beta synthase (CBS) and cystathionine gamma lyase (CSE). Br J Pharmacol. 2013-03-14 [PMID: 23488457]
• Qi F, Zhou Y, Xiao Y et al. Promoter demethylation of cystathionine-b-synthetase gene contributes to inflammatory pain in rats. Pain. 2012-12-25 [PMID: 23273102]

Bioinformatics

• Gene Symbol: CBS
• Entrez:
  • 875(Human)
• Uniprot:
  • NP_000062.1(Human)