CBS Antibody (3E1.)

Images

 
Western Blot: CBS Antibody (3E1) [H00000875-M01] - CBS monoclonal antibody (M01), clone 3E1. Analysis of CBS expression in MCF-7.
Immunohistochemistry-Paraffin: CBS Antibody (3E1) [H00000875-M01] - Analysis of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.
Western Blot: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS over-expressed 293 cell line, cotransfected with CBS Validated Chimera RNAi ( Cat # H00000875-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot ...read more
Western Blot: CBS Antibody (3E1) [H00000875-M01] - CBS monoclonal antibody (M01), clone 3E1 Analysis of CBS expression in HeLa.
Western Blot: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody (M01), clone 3E1.Lane 1: CBS transfected lysate(61 KDa).Lane 2: Non-transfected ...read more
Immunoprecipitation: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CBS MaxPab rabbit polyclonal antibody.
ELISA: CBS Antibody (3E1) [H00000875-M01] - Detection limit for recombinant GST tagged CBS is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Clone
3E1.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CBS Antibody (3E1.) Summary

Immunogen
CBS (NP_000062, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Specificity
CBS - cystathionine-beta-synthase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CBS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 21571312).
Reviewed Applications
Read 1 Review rated 3
using
H00000875-M01 in the following applications:

Publications
Read Publications using
H00000875-M01 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24611772).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBS Antibody (3E1.)

  • cystathionine-beta-synthase
  • EC 4.2.1.2210Beta-thionase

Background

The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02349
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for CBS Antibody (H00000875-M01)(44)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(4)
All Applications
Filter By Species
Human
(2)
Mouse
(3)
Rat
(3)
All Species
Showing Publications 1 - 10 of 44. Show All 44 Publications.
Publications using H00000875-M01 Applications Species
Yue Shang Y, Siow YL, Isaak CK, Karmin O Downregulation of Glutathione Biosynthesis Contributes to Oxidative Stress and Liver Dysfunction in Acute Kidney Injury. Oxid Med Cell Longev 2016 [PMID: 27872680]
Sekiguchi F, Sekimoto T, Ogura A, Kawabata A. Endogenous Hydrogen Sulfide Enhances Cell Proliferation of Human Gastric Cancer AGS Cells. Biol Pharm Bull 2016 May 13 [PMID: 27150157]
Yuan B, Tang WH, Lu LJ et al. TLR4 upregulates CBS expression through NF-kB activation in a rat model of irritable bowel syndrome with chronic visceral hypersensitivity. World J Gastroenterol. 2015 July 28 [PMID: 26229403]
Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2014 [PMID: 25461272]
Du Chenchen, Jin Mengmeng, Hong Yu et al. Downregulation of cystathionine beta-synthase/hydrogen sulfide contributes to rotenone-induced microglia polarization toward M1 type. Biochem Biophys Res Commun. 2014 Aug 22 [PMID: 25086357] (Mouse) Mouse
Takano N, Sarfraz Y, Gilkes DM et al. Decreased Expression of Cystathionine b-Synthase Promotes Glioma Tumorigenesis. Mol Cancer Res. 2014 Jul 03 [PMID: 24994751]
Ida T, Sawa T, Ihara H et al. Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling. Proc Natl Acad Sci U S A. 2014 Apr 14 [PMID: 24733942]
Yamamoto Takehiro, Takano Naoharu, Ishiwata Kyoko et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014 Mar 17 [PMID: 24633012] (WB, Human) WB Human
Miyamoto Ryo, Otsuguro Ken-Ichi, Yamaguchi Soichiro, Ito Shigeo. Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons. J Neurochem. 2014 Mar 27 [PMID: 24611772] (Rat) Rat
Takano N, Peng YJ, Kumar GK et al. Hypoxia-inducible factors regulate human and rat cystathionine b-synthase gene expression. Biochem J. 2013 Dec 12 [PMID: 24328859]
Show All 44 Publications.

Review for CBS Antibody (H00000875-M01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using H00000875-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CBS H00000875-M01
Enlarge
reviewed by:
Anonymous
WB Mouse 02/02/2010
View

Summary

ApplicationWestern Blot
Sample TestedMouse Liver and Lung Tissue, Sample Amount: 15 ug
SpeciesMouse
Lot09258-3E1

Blocking

Blocking DetailsBlocking Buffer: 3% PBS, Blocking Time: 1 hour, Blocking Temp: Room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1/1000, Incubation Dilution Buffer: pbs with 3% of milk, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: RAM, Secondary Ab Dilution Ratio: 1/5000
Secondary Manufacturer Cat#HOMEMADE

Details

Detection NotesDetection Method: ECL, Exposure Time: 10 minutes, Specific Bands: ~66 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBS Antibody (H00000875-M01). (Showing 1 - 2 of 2 FAQs).

  1. We would like to check on Cystathionine beta synthase # H00000875-M01. We need a mouse monoclonal. Applications: Immunoblotting, IHC May I know if this can cross-react with mouse CBS? Because we are actually probing this enzyme in a mouse cell line / tissue and the species is human, host is mouse.
    • This antibody has never been tested against mouse samples so we don't know if it will cross react. I recommend checking with a blast against the mouse protein to find out how similar the immunogen is to the mouse protein. If it is 80% homologous or higher typically there is a good chance it might react. In addition to using an anti-mouse secondary will bind non-specifically to their mouse tissues, and most likely cause high background. Running a secondary only control would be advised or even better increase the concentration of the primary on their samples and use a directly conjugated version to avoid non-specific secondary binding. In this case we can recommend our Innovators Reward Program. Our Innovator's Reward is offered to reward researchers for testing new species and applications with our products. If testing on this antibody is performed on an untested species and/or application, and the results are shared, then the antibody is eligible for the Innovator's Reward. Under this program, Novus will provide you a credit of equal or lesser value on a future product of equal value in exchange for your new data in the form of an online review. The great thing is you are eligible even if the antibody doesn't work because the data is still useful to us.
  2. I was wondering if the CBS Antibody (3E1) (H00000875-M01) has been used for immunofluorescence on monolayer cell cultures?
    • Unfortunately it has never been tested for immunofluorescence in an ICC application on cells. Since it stains tissue, I would imagine it should be capable of staining cells as well. Without testing we cannot guarantee this, but if you want to test using our Innovators Reward Program to save some money for providing feedback that is an option for you. Here are the details: If you would like to test this antibody in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data. The great thing is you are eligible regardless if you get positive results or not.

Secondary Antibodies

 

Isotype Controls

Additional CBS Products

Bioinformatics Tool for CBS Antibody (H00000875-M01)

Discover related pathways, diseases and genes to CBS Antibody (H00000875-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBS Antibody (H00000875-M01)

Discover more about diseases related to CBS Antibody (H00000875-M01).
 

Pathways for CBS Antibody (H00000875-M01)

View related products by pathway.

PTMs for CBS Antibody (H00000875-M01)

Learn more about PTMs related to CBS Antibody (H00000875-M01).
 

Research Areas for CBS Antibody (H00000875-M01)

Find related products by research area.

Blogs on CBS

There are no specific blogs for CBS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
02/02/2010
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol CBS
Entrez
OMIM
Uniprot