CBR1 Antibody (4G11-1C7)

Images

 
Sandwich ELISA: CBR1 Antibody (4G11-1C7) [H00000873-M01] - Detection limit for recombinant GST tagged CBR1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4G11-1C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CBR1 Antibody (4G11-1C7) Summary

Immunogen
CBR1 (AAH02511.1, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Specificity
CBR1 - carbonyl reductase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CBR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000873-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBR1 Antibody (4G11-1C7)

  • 15-hydroxyprostaglandin dehydrogenase [NADP+]
  • carbonyl reductase (NADPH) 1
  • carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase
  • carbonyl reductase [NADPH] 1
  • carbonyl reductase 1
  • CBR
  • CRN
  • EC 1.1.1.184
  • EC 1.1.1.189
  • hCBR1
  • NADPH-dependent carbonyl reductase 1
  • Prostaglandin 9-ketoreductase
  • Prostaglandin-E(2) 9-reductase
  • SDR21C1
  • short chain dehydrogenase/reductase family 21C, member 1

Background

Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-179
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-00997
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-87852
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-13349
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77031
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for CBR1 Antibody (H00000873-M01)(1)

Reviews for CBR1 Antibody (H00000873-M01) (0)

There are no reviews for CBR1 Antibody (H00000873-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBR1 Antibody (H00000873-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBR1 Products

Bioinformatics Tool for CBR1 Antibody (H00000873-M01)

Discover related pathways, diseases and genes to CBR1 Antibody (H00000873-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBR1 Antibody (H00000873-M01)

Discover more about diseases related to CBR1 Antibody (H00000873-M01).
 

Pathways for CBR1 Antibody (H00000873-M01)

View related products by pathway.

PTMs for CBR1 Antibody (H00000873-M01)

Learn more about PTMs related to CBR1 Antibody (H00000873-M01).
 

Research Areas for CBR1 Antibody (H00000873-M01)

Find related products by research area.

Blogs on CBR1

There are no specific blogs for CBR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBR1 Antibody (4G11-1C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CBR1
Entrez
OMIM
Uniprot