CBP20 Antibody

Images

 
Western Blot: CBP20 Antibody [NBP1-91755] - Analysis in human cell line TD47D.
Immunocytochemistry/ Immunofluorescence: CBP20 Antibody [NBP1-91755] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CBP20 Antibody [NBP1-91755] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CBP20 Antibody [NBP1-91755] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: CBP20 Antibody [NBP1-91755] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: CBP20 Antibody [NBP1-91755] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Product Discontinued
View other related CBP20 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-91755
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CBP20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLS
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBP20 Protein (NBP1-91755PEP)
Publications
Read Publication using NBP1-91755.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24270878)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBP20 Antibody

  • 20 kDa nuclear cap-binding protein
  • Cbc2
  • CBP20CBC2
  • NCBP 20 kDa subunit
  • NCBP interacting protein 1
  • NCBP-interacting protein 1
  • NIP1Cell proliferation-inducing gene 55 protein
  • nuclear cap binding protein subunit 2, 20kD
  • nuclear cap binding protein subunit 2, 20kDa
  • nuclear cap-binding protein subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33897
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-00702
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56150
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC, IHC-P, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-24570
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-16787
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-30725
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-93521
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-67842
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00090527-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for CBP20 Antibody (NBP1-91755)(1)

Reviews for CBP20 Antibody (NBP1-91755) (0)

There are no reviews for CBP20 Antibody (NBP1-91755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBP20 Antibody (NBP1-91755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBP20 Products

Bioinformatics Tool for CBP20 Antibody (NBP1-91755)

Discover related pathways, diseases and genes to CBP20 Antibody (NBP1-91755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBP20 Antibody (NBP1-91755)

Discover more about diseases related to CBP20 Antibody (NBP1-91755).
 

Pathways for CBP20 Antibody (NBP1-91755)

View related products by pathway.

Research Areas for CBP20 Antibody (NBP1-91755)

Find related products by research area.

Blogs on CBP20

There are no specific blogs for CBP20, but you can read our latest blog posts.
Omicron Variant Antibodies

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBP20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCBP2