Recombinant Human Caveolin-3 Protein

Images

 
SDS-Page: Recombinant Human Caveolin-3 Protein [H00000859-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Caveolin-3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-151 of Human CAV3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CAV3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caveolin-3 Protein

  • CAV3
  • caveolin 3
  • Caveolin3
  • Caveolin-3
  • LGMD1C
  • LGMD1CMGC126100
  • LQT9
  • LQT9MGC126101
  • M-caveolin
  • MGC126129
  • VIP21
  • VIP-21

Background

This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
AF3049
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00000859-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Caveolin-3 Recombinant Protein (H00000859-P01) (0)

There are no publications for Caveolin-3 Recombinant Protein (H00000859-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caveolin-3 Recombinant Protein (H00000859-P01) (0)

There are no reviews for Caveolin-3 Recombinant Protein (H00000859-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caveolin-3 Recombinant Protein (H00000859-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caveolin-3 Products

Bioinformatics Tool for Caveolin-3 Recombinant Protein (H00000859-P01)

Discover related pathways, diseases and genes to Caveolin-3 Recombinant Protein (H00000859-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caveolin-3 Recombinant Protein (H00000859-P01)

Discover more about diseases related to Caveolin-3 Recombinant Protein (H00000859-P01).
 

Pathways for Caveolin-3 Recombinant Protein (H00000859-P01)

View related products by pathway.

PTMs for Caveolin-3 Recombinant Protein (H00000859-P01)

Learn more about PTMs related to Caveolin-3 Recombinant Protein (H00000859-P01).

Blogs on Caveolin-3

There are no specific blogs for Caveolin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caveolin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAV3
Entrez