Recombinant Human Caveolin-3 Protein

Images

 
SDS-Page: Recombinant Human Caveolin-3 Protein [H00000859-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Caveolin-3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-83 of Human Caveolin-3

Source: Wheat Germ

Amino Acid Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CAV3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00000859-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caveolin-3 Protein

  • CAV3
  • caveolin 3
  • Caveolin3
  • Caveolin-3
  • LGMD1C
  • LGMD1CMGC126100
  • LQT9
  • LQT9MGC126101
  • M-caveolin
  • MGC126129
  • VIP21
  • VIP-21

Background

CAV3 - caveolin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
AF3049
Species: Hu
Applications: WB, IHC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34061
Species: Hu
Applications: IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P

Publications for Caveolin-3 Partial Recombinant Protein (H00000859-Q01)(1)


Reviews for Caveolin-3 Partial Recombinant Protein (H00000859-Q01) (0)

There are no reviews for Caveolin-3 Partial Recombinant Protein (H00000859-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caveolin-3 Partial Recombinant Protein (H00000859-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caveolin-3 Products

Bioinformatics Tool for Caveolin-3 Partial Recombinant Protein (H00000859-Q01)

Discover related pathways, diseases and genes to Caveolin-3 Partial Recombinant Protein (H00000859-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caveolin-3 Partial Recombinant Protein (H00000859-Q01)

Discover more about diseases related to Caveolin-3 Partial Recombinant Protein (H00000859-Q01).
 

Pathways for Caveolin-3 Partial Recombinant Protein (H00000859-Q01)

View related products by pathway.

PTMs for Caveolin-3 Partial Recombinant Protein (H00000859-Q01)

Learn more about PTMs related to Caveolin-3 Partial Recombinant Protein (H00000859-Q01).

Blogs on Caveolin-3

There are no specific blogs for Caveolin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caveolin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAV3