Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1H. Source: E.coli Amino Acid Sequence: EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | CACNA1H |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This peptide is useful as a blocking peptide for NBP1-88176.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW | 27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Diseases for Cav3.2 Protein (NBP1-88176PEP)Discover more about diseases related to Cav3.2 Protein (NBP1-88176PEP).
| Pathways for Cav3.2 Protein (NBP1-88176PEP)View related products by pathway.
|
PTMs for Cav3.2 Protein (NBP1-88176PEP)Learn more about PTMs related to Cav3.2 Protein (NBP1-88176PEP).
| Research Areas for Cav3.2 Protein (NBP1-88176PEP)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CACNA1H |