We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cav3.2 Recombinant Protein Antigen

Images

 
There are currently no images for Cav3.2 Protein (NBP1-88176PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cav3.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1H.

Source: E. coli

Amino Acid Sequence: EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1H
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88176.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cav3.2 Recombinant Protein Antigen

  • CACNA1H
  • CACNA1HB
  • calcium channel, voltage-dependent, T type, alpha 1H subunit
  • calcium channel, voltage-dependent, T type, alpha 1Hb subunit
  • Cav3.2
  • ECA6
  • EIG6
  • FLJ90484
  • Low-voltage-activated calcium channel alpha1 3.2 subunit
  • low-voltage-activated calcium channel alpha13.2 subunit
  • voltage dependent t-type calcium channel alpha-1H subunit
  • voltage-dependent T-type calcium channel subunit alpha-1H
  • voltage-gated calcium channel alpha subunit Cav3.2
  • voltage-gated calcium channel alpha subunit CavT.2
  • Voltage-gated calcium channel subunit alpha Cav3.2

Background

Ion channels are integral membrane proteins that help establish and control the small voltage gradient across the plasma membrane of living cells by allowing the flow of ions down their electrochemical gradient (1). They are present in the membranes that surround all biological cells because their main function is to regulate the flow of ions across this membrane. Whereas some ion channels permit the passage of ions based on charge, others conduct based on a ionic species, such as sodium or potassium. Furthermore, in some ion channels, the passage is governed by a gate which is controlled by chemical or electrical signals, temperature, or mechanical forces. There are a few main classifications of gated ion channels. There are voltage- gated ion channels, ligandgated, other gating systems and finally those that are classified differently, having more exotic characteristics. The first are voltage- gated ion channels which open and close in response to membrane potential. These are then separated into sodium, calcium, potassium, proton, transient receptor, and cyclic nucleotide-gated channels; each of which is responsible for a unique role. Ligand-gated ion channels are also known as ionotropic receptors, and they open in response to specific ligand molecules binding to the extracellular domain of the receptor protein. The other gated classifications include activation and inactivation by second messengers, inwardrectifier potassium channels, calcium-activated potassium channels, two-pore-domain potassium channels, light-gated channels, mechano-sensitive ion channels and cyclic nucleotide-gated channels. Finally, the other classifications are based on less normal characteristics such as two-pore channels, and transient receptor potential channels (2). Specifically, Cav3.2 is a protein which in humans is encoded by the CACNA1H gene. Studies suggest certain mutations in this gene lead to childhood absence epilepsy (3, 4). Studies also suggest that the up-regulations of Cav3.2 may participate in the progression of prostate cancer toward an androgen-independent stage (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-30674
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NB100-757
Species: Hu
Applications: ChIP, IHC,  IHC-P, WB
NBP3-47733
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP3-52364
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-81767
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
QET00B
Species: Hu
Applications: ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7447
Species: Hu
Applications: IHC, WB
NBP3-46655
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for Cav3.2 Protein (NBP1-88176PEP) (0)

There are no publications for Cav3.2 Protein (NBP1-88176PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cav3.2 Protein (NBP1-88176PEP) (0)

There are no reviews for Cav3.2 Protein (NBP1-88176PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cav3.2 Protein (NBP1-88176PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cav3.2 Products

Array NBP1-88176PEP

Research Areas for Cav3.2 Protein (NBP1-88176PEP)

Find related products by research area.

Blogs on Cav3.2

There are no specific blogs for Cav3.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cav3.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1H