Cav3.2 Recombinant Protein Antigen

Images

 
There are currently no images for Cav3.2 Protein (NBP1-88176PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cav3.2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CACNA1H.

Source: E.coli

Amino Acid Sequence: EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CACNA1H
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88176.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Cav3.2 Recombinant Protein Antigen

  • CACNA1HB
  • calcium channel, voltage-dependent, T type, alpha 1H subunit
  • calcium channel, voltage-dependent, T type, alpha 1Hb subunit
  • Cav3.2
  • ECA6
  • EIG6
  • FLJ90484
  • Low-voltage-activated calcium channel alpha1 3.2 subunit
  • low-voltage-activated calcium channel alpha13.2 subunit
  • voltage dependent t-type calcium channel alpha-1H subunit
  • voltage-dependent T-type calcium channel subunit alpha-1H
  • voltage-gated calcium channel alpha subunit Cav3.2
  • voltage-gated calcium channel alpha subunit CavT.2
  • Voltage-gated calcium channel subunit alpha Cav3.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-30674
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NBP1-91744
Species: Hu
Applications: IHC, IHC-P
NBP3-17155
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-76923
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF009
Species: Hu
Applications: IHC, WB
NBP2-75641
Species: Hu, Mu
Applications: ICC/IF, IHC-P, IP, WB
QET00B
Species: Hu
Applications: ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7447
Species: Hu
Applications: IHC, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for Cav3.2 Protein (NBP1-88176PEP) (0)

There are no publications for Cav3.2 Protein (NBP1-88176PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cav3.2 Protein (NBP1-88176PEP) (0)

There are no reviews for Cav3.2 Protein (NBP1-88176PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cav3.2 Protein (NBP1-88176PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cav3.2 Products

Array NBP1-88176PEP

Bioinformatics Tool for Cav3.2 Protein (NBP1-88176PEP)

Discover related pathways, diseases and genes to Cav3.2 Protein (NBP1-88176PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cav3.2 Protein (NBP1-88176PEP)

Discover more about diseases related to Cav3.2 Protein (NBP1-88176PEP).
 

Pathways for Cav3.2 Protein (NBP1-88176PEP)

View related products by pathway.

PTMs for Cav3.2 Protein (NBP1-88176PEP)

Learn more about PTMs related to Cav3.2 Protein (NBP1-88176PEP).
 

Research Areas for Cav3.2 Protein (NBP1-88176PEP)

Find related products by research area.

Blogs on Cav3.2

There are no specific blogs for Cav3.2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cav3.2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA1H