Cathepsin O Antibody

Images

 
Western Blot: Cathepsin O Antibody [NBP1-90610] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Cathepsin O Antibody [NBP1-90610] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cathepsin O Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cathepsin O Protein (NBP1-90610PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cathepsin O Antibody

  • Cathepsin O
  • CTSO
  • CTSO1
  • EC 3.4.22.42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
MAB7876
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1294
Species: Hu, Mu, Rt, Am, Ca, Ch
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-90610
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cathepsin O Antibody (NBP1-90610) (0)

There are no publications for Cathepsin O Antibody (NBP1-90610).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin O Antibody (NBP1-90610) (0)

There are no reviews for Cathepsin O Antibody (NBP1-90610). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin O Antibody (NBP1-90610) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin O Products

Bioinformatics Tool for Cathepsin O Antibody (NBP1-90610)

Discover related pathways, diseases and genes to Cathepsin O Antibody (NBP1-90610). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin O Antibody (NBP1-90610)

Discover more about diseases related to Cathepsin O Antibody (NBP1-90610).
 

Pathways for Cathepsin O Antibody (NBP1-90610)

View related products by pathway.

Blogs on Cathepsin O

There are no specific blogs for Cathepsin O, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin O Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSO
Entrez