Casein Kinase 2 beta Antibody

Images

 
Western Blot: Casein Kinase 2 beta Antibody [NBP1-87483] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Casein Kinase 2 beta Antibody [NBP1-87483] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Casein Kinase 2 beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSNK2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Casein Kinase 2 beta Protein (NBP1-87483PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Casein Kinase 2 beta Antibody

  • Casein Kinase 2 beta
  • casein kinase 2, beta polypeptide
  • Casein kinase II beta subunit
  • casein kinase II subunit beta
  • CK II beta
  • CK2B
  • CK2N
  • CSK2B
  • CSNK2B
  • G5A
  • MGC138222
  • MGC138224
  • Phosvitin
  • Protein G5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00149420-P01
Species: Hu
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-2720
Species: Hu
Applications: WB, IHC
MAB7957
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87483
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Casein Kinase 2 beta Antibody (NBP1-87483) (0)

There are no publications for Casein Kinase 2 beta Antibody (NBP1-87483).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 2 beta Antibody (NBP1-87483) (0)

There are no reviews for Casein Kinase 2 beta Antibody (NBP1-87483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Casein Kinase 2 beta Antibody (NBP1-87483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 2 beta Products

Bioinformatics Tool for Casein Kinase 2 beta Antibody (NBP1-87483)

Discover related pathways, diseases and genes to Casein Kinase 2 beta Antibody (NBP1-87483). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 2 beta Antibody (NBP1-87483)

Discover more about diseases related to Casein Kinase 2 beta Antibody (NBP1-87483).
 

Pathways for Casein Kinase 2 beta Antibody (NBP1-87483)

View related products by pathway.

PTMs for Casein Kinase 2 beta Antibody (NBP1-87483)

Learn more about PTMs related to Casein Kinase 2 beta Antibody (NBP1-87483).
 

Research Areas for Casein Kinase 2 beta Antibody (NBP1-87483)

Find related products by research area.

Blogs on Casein Kinase 2 beta

There are no specific blogs for Casein Kinase 2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 2 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2B
Entrez