Novus Biologicals products are now on bio-techne.com

Casein Kinase 2 beta Antibody (9T5J10)

Images

 
Western Blot: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at 1:1000 dilution. Secondary ...read more
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 ...read more
Immunohistochemistry-Paraffin: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Mouse spinal cord using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens).Perform microwave ...read more
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of ...read more
Immunohistochemistry-Paraffin: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Rat brain using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: Casein Kinase 2 beta Antibody (9T5J10) [NBP3-16264] - Human colon carcinoma using Casein Kinase 2 beta (CSNK2B) Rabbit mAb (NBP3-16264) at dilution of 1:100 (40x lens).Perform microwave ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
9T5J10
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Casein Kinase 2 beta Antibody (9T5J10) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (P67870). YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
CSNK2B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Casein Kinase 2 beta Antibody (9T5J10)

  • Casein Kinase 2 beta
  • casein kinase 2, beta polypeptide
  • Casein kinase II beta subunit
  • casein kinase II subunit beta
  • CK II beta
  • CK2B
  • CK2N
  • CSK2B
  • CSNK2B
  • G5A
  • MGC138222
  • MGC138224
  • Phosvitin
  • Protein G5a

Background

Casein Kinase 2 beta encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00149420-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-922
Species: Ch
Applications: ELISA, IHC, IP, Single-Cell Western, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-88188
Species: Hu
Applications: IHC, IHC-P
MAB7957
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47754
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Casein Kinase 2 beta Antibody (NBP3-16264) (0)

There are no publications for Casein Kinase 2 beta Antibody (NBP3-16264).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 2 beta Antibody (NBP3-16264) (0)

There are no reviews for Casein Kinase 2 beta Antibody (NBP3-16264). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Casein Kinase 2 beta Antibody (NBP3-16264) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 2 beta Products

Research Areas for Casein Kinase 2 beta Antibody (NBP3-16264)

Find related products by research area.

Blogs on Casein Kinase 2 beta

There are no specific blogs for Casein Kinase 2 beta, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 2 beta Antibody (9T5J10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2B