Casein Kinase 2 alpha Antibody (3D9)

Images

 
Western Blot: Casein Kinase 2 alpha Antibody (3D9) [H00001457-M01] - CSNK2A1 monoclonal antibody (M01), clone 3D9 Analysis of CSNK2A1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: Casein Kinase 2 alpha Antibody (3D9) [H00001457-M01] - Analysis of monoclonal antibody to CSNK2A1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Casein Kinase 2 alpha Antibody (3D9) [H00001457-M01] - Analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody (M01), clone 3D9.Lane 1: CSNK2A1 transfected lysate(45.1 ...read more
Proximity Ligation Assay: Casein Kinase 2 alpha Antibody (3D9) [H00001457-M01] - Analysis of protein-protein interactions between TP53 and CSNK2A1. HeLa cells were stained with anti-TP53 rabbit purified polyclonal ...read more
Sandwich ELISA: Casein Kinase 2 alpha Antibody (3D9) [H00001457-M01] - Detection limit for recombinant GST tagged CSNK2A1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA
Clone
3D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Casein Kinase 2 alpha Antibody (3D9) Summary

Immunogen
CSNK2A1 (AAH11668, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Specificity
CSNK2A1 (3D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSNK2A1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00001457-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Casein Kinase 2 alpha Antibody (3D9)

  • Casein Kinase 2 alpha
  • casein kinase 2, alpha 1 polypeptide
  • casein kinase II alpha 1 subunit
  • CK II alpha
  • CK2 catalytic subunit alpha
  • CK2A1
  • CK2A1casein kinase II subunit alpha
  • CKII
  • CSNK2A1
  • EC 2.7.11
  • EC 2.7.11.1
  • protein kinase CK2

Background

Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. While this gene is found on chromosome 20, a related transcribed pseudogene is found on chromosome 11. Three transcript variants encoding two different proteins have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-60052
Species: Hu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00149420-P01
Species: Hu
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for Casein Kinase 2 alpha Antibody (H00001457-M01)(1)

Reviews for Casein Kinase 2 alpha Antibody (H00001457-M01) (0)

There are no reviews for Casein Kinase 2 alpha Antibody (H00001457-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Casein Kinase 2 alpha Antibody (H00001457-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 2 alpha Products

Bioinformatics Tool for Casein Kinase 2 alpha Antibody (H00001457-M01)

Discover related pathways, diseases and genes to Casein Kinase 2 alpha Antibody (H00001457-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 2 alpha Antibody (H00001457-M01)

Discover more about diseases related to Casein Kinase 2 alpha Antibody (H00001457-M01).
 

Pathways for Casein Kinase 2 alpha Antibody (H00001457-M01)

View related products by pathway.

Research Areas for Casein Kinase 2 alpha Antibody (H00001457-M01)

Find related products by research area.

Blogs on Casein Kinase 2 alpha

There are no specific blogs for Casein Kinase 2 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 2 alpha Antibody (3D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2A1
Entrez
OMIM
Uniprot