Casein Kinase 1 gamma Antibody - BSA Free

Western Blot: Casein Kinase 1 gamma Antibody [NBP1-80262] - Titration: 5.0ug/ml, Positive Control: SP2/0 cell lysate.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Casein Kinase 1 gamma Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of mouse CSNK1G1. Peptide sequence CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFERKGYTFDYAYDW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK1G1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Casein Kinase 1 gamma Antibody - BSA Free

• Casein Kinase 1 gamma
• casein kinase 1, gamma 1
• casein kinase I isoform gamma-1
• CKI-gamma 1
• CSNK1G1
• EC 2.7.11
• EC 2.7.11.1

Background

Casein kinase I (also designated CKI) and casein kinase II (also designated CKII) compose a family of serine/ threonine protein kinases which are present in all eukaryotes examined to date. CKI family members, which include CKIalpha, gamma, episilon and delta, have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. CKII is usually expressed as a tetrameric complex consisting of either an alpha2beta2 or an alphaalpha'beta2 structure. The alpha catalytic subunit is stimulated by the beta regulatory subunit, which undergoes autophosphorylation. CKII activity is high in the cytosol and nucleus of proliferating and differentiating cells. CKII is known to phosphorylate more than 100 different substrates including nuclear oncoproteins, transcription factors and enzymes involved in DNA metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK1G1
• Uniprot:
  • NP_775277(Mouse)