Recombinant Human CARD11/CARMA1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CARD11/CARMA1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 481-580 of Human CARD11/CARMA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CARD11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CARD11/CARMA1 GST (N-Term) Protein

  • BIMP3
  • BIMP3card-maguk protein 1
  • CARD11
  • CARD-containing MAGUK protein 1
  • Carma 1
  • CARMA1
  • CARMA1bcl10-interacting maguk protein 3
  • caspase recruitment domain family, member 11
  • caspase recruitment domain-containing protein 11
  • MGC133069

Background

CARD11 - caspase recruitment domain family, member 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02597
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56158
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB4368
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
AF5129
Species: Hu
Applications: WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP1-33042
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-46228
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-56704
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-37975
Species: Hu
Applications: IHC, IHC-P
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00084433-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01) (0)

There are no publications for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01) (0)

There are no reviews for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CARD11/CARMA1 Products

Bioinformatics Tool for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01)

Discover related pathways, diseases and genes to CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01)

Discover more about diseases related to CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01).
 

Pathways for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01)

View related products by pathway.

PTMs for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01)

Learn more about PTMs related to CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01).
 

Research Areas for CARD11/CARMA1 Partial Recombinant Protein (H00084433-Q01)

Find related products by research area.

Blogs on CARD11/CARMA1

There are no specific blogs for CARD11/CARMA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CARD11/CARMA1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD11