Carboxypeptidase A4/CPA4 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Carboxypeptidase A4/CPA4. Peptide sequence: IVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CPA4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Carboxypeptidase A4/CPA4 Antibody - BSA Free
Background
Metalloprotease that could be involved in the histone hyperacetylation pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, Neut, WB
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Publications for Carboxypeptidase A4/CPA4 Antibody (NBP2-84589) (0)
There are no publications for Carboxypeptidase A4/CPA4 Antibody (NBP2-84589).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carboxypeptidase A4/CPA4 Antibody (NBP2-84589) (0)
There are no reviews for Carboxypeptidase A4/CPA4 Antibody (NBP2-84589).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Carboxypeptidase A4/CPA4 Antibody (NBP2-84589) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Carboxypeptidase A4/CPA4 Products
Research Areas for Carboxypeptidase A4/CPA4 Antibody (NBP2-84589)
Find related products by research area.
|
Blogs on Carboxypeptidase A4/CPA4