Carbonic Anhydrase VII/CA7 Recombinant Protein Antigen

Images

 
There are currently no images for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carbonic Anhydrase VII/CA7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CA7.

Source: E. coli

Amino Acid Sequence: PINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CA7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30702.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbonic Anhydrase VII/CA7 Recombinant Protein Antigen

  • CA7
  • Carbonate dehydratase VII
  • carbonic anhydrase 7
  • Carbonic Anhydrase VII
  • carbonic anhydrase VIICAVII
  • carbonic dehydratase VII
  • CA-VII
  • EC 4.2.1.1

Background

CA7, also known as Carbonic Anhydrase 7, consists of a 29 kDa and a shorter 23 kDa isoform, is involved in zinc ion binding as a member of the zinc metalloenzyme family that transports HCO3- and a proton (H+) into H20 and CO2. This process occurs in several pathways such as the metabolism and reversible hydration of carbon dioxide pathways. Disease research is currently being studied with relation to CA7 and colorectal cancer, glaucoma, insulin resistance and neuronitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87537
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-919
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, MiAr, PLA, Simple Western, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
DPSG10
Species: Hu
Applications: ELISA

Publications for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP) (0)

There are no publications for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP) (0)

There are no reviews for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase VII/CA7 Products

Research Areas for Carbonic Anhydrase VII/CA7 Protein (NBP2-30702PEP)

Find related products by research area.

Blogs on Carbonic Anhydrase VII/CA7

There are no specific blogs for Carbonic Anhydrase VII/CA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbonic Anhydrase VII/CA7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CA7