Recombinant Human Carbonic Anhydrase VA/CA5A Protein

Images

 

Order Details


    • Catalog Number
      H00000763-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Carbonic Anhydrase VA/CA5A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-305 of Human CA5A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CA5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
61.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Carbonic Anhydrase VA/CA5A Protein

  • CA5A
  • CA5carbonic anhydrase 5A, mitochondrial
  • Carbonate dehydratase VA
  • carbonic anhydrase V, mitochondrial
  • Carbonic Anhydrase VA
  • carbonic anhydrase VA, mitochondrial
  • carbonic dehydratase
  • CAV
  • CAVA
  • CA-VA
  • EC 4.2.1.1

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB110-5029
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP1-31116
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
4308-SE
Species: Hu
Applications: EnzAct
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
AF6989
Species: Mu
Applications: IHC
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00000763-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Carbonic Anhydrase VA/CA5A Recombinant Protein (H00000763-P01) (0)

There are no publications for Carbonic Anhydrase VA/CA5A Recombinant Protein (H00000763-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbonic Anhydrase VA/CA5A Recombinant Protein (H00000763-P01) (0)

There are no reviews for Carbonic Anhydrase VA/CA5A Recombinant Protein (H00000763-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase VA/CA5A Recombinant Protein (H00000763-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbonic Anhydrase VA/CA5A Products

Research Areas for Carbonic Anhydrase VA/CA5A Recombinant Protein (H00000763-P01)

Find related products by research area.

Blogs on Carbonic Anhydrase VA/CA5A

There are no specific blogs for Carbonic Anhydrase VA/CA5A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Carbonic Anhydrase VA/CA5A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CA5A