CAPZA3 Antibody

Western Blot: CAPZA3 Antibody [NBP1-56416] - DU145 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

CAPZA3 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CAPZA3(capping protein (actin filament) muscle Z-line, alpha 3) The peptide sequence was selected from the N terminal of CAPZA3. Peptide sequence MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha-3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPZA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CAPZA3 Antibody

• CAPAA3
• CAPPA3F-actin capping protein alpha-3 subunit
• capping protein (actin filament) muscle Z-line, alpha 3
• CapZ alpha-3
• CP-alpha-3
• F-actin-capping protein subunit alpha-3
• Germ cell-specific protein 3
• Gsg3

Background

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. CAPZA3 may play a role in the morphogenesis of spermatid.This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPZA3
• Uniprot:
  • Q96KX2(Human)