CAMSAP1L1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human cell line U-2 OS shows positivity in cytoplasm & microtubule plus end.

Immunohistochemistry-Paraffin: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human cerebral cortex, placenta, prostate and testis using Anti-CAMSAP2 antibody NBP1-82934 (A) shows similar protein distribution across tissues to independent antibody NBP1-82935 (B).

Immunohistochemistry-Paraffin: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAMSAP1L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CAMSAP1L1 Antibody - BSA Free (NBP1-82934) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKM
• Predicted Species: Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMSAP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CAMSAP1L1 Protein (NBP1-82934PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CAMSAP1L1 Antibody - BSA Free

• calmodulin regulated spectrin-associated protein 1-like 1
• calmodulin-regulated spectrin-associated protein 2
• CAMSAP2
• KIAA1078Calmodulin-regulated spectrin-associated protein 1-like protein 1
• MGC150680
• MGC150681

Background

CAMSAP1L1 (calmodulin-regulated spectrin-associated protein 1-like protein 1) is related to CAMSAP1. Both contain an N-terminal CH (calponin homology domain) which is an actin-binding domain found in cytoskeletal and signal transduction proteins. The CAMSAP1 family of proteins also contains a unique C-terminal CKK (DUF1781) domain which has been found to bind microtubules. The function of CAMSAP1L1 has not been characterized. CAMSAP1L1 is also known as KIAA7078.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMSAP2