CAMSAP1L1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human cell line U-2 OS shows positivity in cytoplasm & microtubule plus end.
Immunohistochemistry: CAMSAP1L1 Antibody [NBP1-82934] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAMSAP1L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAMSAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAMSAP1L1 Protein (NBP1-82934PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAMSAP1L1 Antibody

  • calmodulin regulated spectrin-associated protein 1-like 1
  • calmodulin-regulated spectrin-associated protein 2
  • CAMSAP2
  • KIAA1078Calmodulin-regulated spectrin-associated protein 1-like protein 1
  • MGC150680
  • MGC150681

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-21021
Species: Hu
Applications: WB, ICC/IF
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-86306
Species: Hu
Applications: IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-21502
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26645
Species: Hu, Rt
Applications: WB, IP
NBP2-55757
Species: Hu
Applications: ICC/IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-93499
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-82934
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CAMSAP1L1 Antibody (NBP1-82934) (0)

There are no publications for CAMSAP1L1 Antibody (NBP1-82934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMSAP1L1 Antibody (NBP1-82934) (0)

There are no reviews for CAMSAP1L1 Antibody (NBP1-82934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CAMSAP1L1 Antibody (NBP1-82934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAMSAP1L1 Products

Bioinformatics Tool for CAMSAP1L1 Antibody (NBP1-82934)

Discover related pathways, diseases and genes to CAMSAP1L1 Antibody (NBP1-82934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CAMSAP1L1 Antibody (NBP1-82934)

View related products by pathway.

Blogs on CAMSAP1L1

There are no specific blogs for CAMSAP1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAMSAP1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMSAP2