CaMKK2 Antibody [Janelia Fluor® 549]

Product Discontinued

CaMKK2 Antibody [Janelia Fluor® 549] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CaMKK2 (NP_006540.3).
  
  Sequence:
  MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMKK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for CaMKK2 Antibody [Janelia Fluor® 549]

• calcium/calmodulin-dependent protein kinase kinase 2
• calcium/calmodulin-dependent protein kinase kinase 2, beta
• Calcium/calmodulin-dependent protein kinase kinase beta
• CaM-kinase kinase 2
• CaM-kinase kinase beta
• CaMKK 2
• CaM-KK 2
• CAMKK beta protein
• CaMKK beta
• CaM-KK beta
• CAMKK
• CaMKK2
• CAMKKB
• CAMKKBCaMKK 2
• EC 2.7.11
• EC 2.7.11.17
• KIAA0787
• KIAA0787calcium/calmodulin-dependent protein kinase beta
• MGC15254

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMKK2