CaM Kinase II gamma Antibody - BSA Free

Western Blot: CaM Kinase II gamma Antibody [NBP2-57797] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: CaM Kinase II gamma Antibody [NBP2-57797] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaM Kinase II gamma Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CaM Kinase II gamma Antibody - BSA Free (NBP2-57797) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMK2G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CaM Kinase II gamma Recombinant Protein Antigen (NBP2-57797PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CaM Kinase II gamma Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase (CaM kinase) II gamma
• calcium/calmodulin-dependent protein kinase II gamma
• calcium/calmodulin-dependent protein kinase type II subunit gamma
• CaM Kinase II gamma
• CaM kinase II subunit gamma
• CAMK
• CAMK2G
• CAMKG
• CAMKGFLJ16043
• CaMK-II subunit gamma
• CAMK-II
• EC 2.7.11
• EC 2.7.11.17
• MGC26678

Background

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Six alternatively spliced variants that encode six different isoforms have been characterized to date. Additional alternative splice variants that encode different isoforms have been described, but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMK2G