Calsenilin Antibody - BSA Free

Immunohistochemistry-Paraffin: Calsenilin Antibody [NBP2-57209] - Staining of human cerebral cortex shows cytoplasmic positivity in axonal projections.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calsenilin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calsenilin Antibody - BSA Free (NBP2-57209) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNIP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calsenilin Recombinant Protein Antigen (NBP2-57209PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Calsenilin Antibody - BSA Free

• calsenilin
• calsenilin, presenilin-binding protein, EF hand transcription factor
• CSEN MGC18289
• DREAM
• DREAMA-type potassium channel modulatory protein 3
• KCHIP3 DRE-antagonist modulator
• KChIP3
• Kv channel interacting protein 3, calsenilin
• Kv channel-interacting protein 3
• potassium channel interacting protein 3

Background

The human prodynorphin gene, which is involved in memory acquisition and pain, is regulated by its downstream regulatory element (DRE). The DRE acts as a location-dependent gene silencer. DREAM is a transcriptional repressor, DRE-antagonist modulator. It is the first known Ca2+ binding protein that binds to DNA and regulates transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNIP3