Calsenilin Antibody - BSA Free

Western Blot: Calsenilin Antibody [NBP1-82380] - Calsenilin Antibody Mouse Pancreas Lysate 1.0 ug/ml, gel concentration 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Calsenilin Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide towards CSEN. Peptide sequence PMSMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNIP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Calsenilin Antibody - BSA Free

• calsenilin
• calsenilin, presenilin-binding protein, EF hand transcription factor
• CSEN MGC18289
• DREAM
• DREAMA-type potassium channel modulatory protein 3
• KCHIP3 DRE-antagonist modulator
• KChIP3
• Kv channel interacting protein 3, calsenilin
• Kv channel-interacting protein 3
• potassium channel interacting protein 3

Background

The human prodynorphin gene, which is involved in memory acquisition and pain, is regulated by its downstream regulatory element (DRE). The DRE acts as a location-dependent gene silencer. DREAM is a transcriptional repressor, DRE-antagonist modulator. It is the first known Ca2+ binding protein that binds to DNA and regulates transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNIP3
• Uniprot:
  • NP_001104801(Mouse)