CALHM1 Antibody

Images

 
Immunohistochemistry-Paraffin: CALHM1 Antibody [NBP1-83930] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CALHM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALHM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CALHM1 Protein (NBP1-83930PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CALHM1 Antibody

  • calcium homeostasis modulator 1
  • FAM26Ccalcium homeostasis modulator protein 1
  • family with sequence similarity 26, member C
  • MGC39514
  • MGC39617
  • Protein FAM26C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-87936
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92462
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83099
Species: Hu
Applications: IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-90507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50627
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-59355
Species: Hu
Applications: WB, IHC, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
640-A3
Species: Mu

Publications for CALHM1 Antibody (NBP1-83930) (0)

There are no publications for CALHM1 Antibody (NBP1-83930).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALHM1 Antibody (NBP1-83930) (0)

There are no reviews for CALHM1 Antibody (NBP1-83930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CALHM1 Antibody (NBP1-83930) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CALHM1 Products

Bioinformatics Tool for CALHM1 Antibody (NBP1-83930)

Discover related pathways, diseases and genes to CALHM1 Antibody (NBP1-83930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALHM1 Antibody (NBP1-83930)

Discover more about diseases related to CALHM1 Antibody (NBP1-83930).
 

Pathways for CALHM1 Antibody (NBP1-83930)

View related products by pathway.

PTMs for CALHM1 Antibody (NBP1-83930)

Learn more about PTMs related to CALHM1 Antibody (NBP1-83930).

Blogs on CALHM1

There are no specific blogs for CALHM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CALHM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALHM1