ANO7 Antibody

Images

 
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP1-83099] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANO7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANO7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANO7 Protein (NBP1-83099PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANO7 Antibody

  • anoctamin 7
  • Dresden transmembrane protein of the prostate
  • IPCA-5IPCA5
  • New gene expressed in prostate
  • NGEPD-TMPP
  • PCANAP5anoctamin-7
  • PCANAP5L
  • prostate cancer associated protein 5
  • prostate cancer-associated gene 5
  • Prostate cancer-associated protein 5
  • TMEM16GDresden-transmembrane protein of the prostate
  • Transmembrane protein 16GDTMPP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84207
Species: Hu
Applications: IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-92462
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24552
Species: Hu, Mu, Pm
Applications: WB, Simple Western, IHC-P
NBP1-77112
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-90507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87936
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59355
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ANO7 Antibody (NBP1-83099) (0)

There are no publications for ANO7 Antibody (NBP1-83099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANO7 Antibody (NBP1-83099) (0)

There are no reviews for ANO7 Antibody (NBP1-83099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANO7 Antibody (NBP1-83099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANO7 Products

Bioinformatics Tool for ANO7 Antibody (NBP1-83099)

Discover related pathways, diseases and genes to ANO7 Antibody (NBP1-83099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANO7 Antibody (NBP1-83099)

Discover more about diseases related to ANO7 Antibody (NBP1-83099).
 

Pathways for ANO7 Antibody (NBP1-83099)

View related products by pathway.

PTMs for ANO7 Antibody (NBP1-83099)

Learn more about PTMs related to ANO7 Antibody (NBP1-83099).

Blogs on ANO7

There are no specific blogs for ANO7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANO7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANO7
Entrez
Uniprot