Recombinant Human Caldesmon/CALD1 Protein

Images

 
SDS-Page: Recombinant Human Caldesmon/CALD1 Protein [H00000800-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Caldesmon/CALD1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-538 of Human CALD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CALD1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caldesmon/CALD1 Protein

  • CAD
  • CALD1
  • caldesmon 1
  • Caldesmon
  • CDM
  • CDMH-CAD
  • HCAD
  • LCAD
  • L-CAD
  • MGC21352
  • NAG22

Background

This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi

Publications for Caldesmon/CALD1 Recombinant Protein (H00000800-P01) (0)

There are no publications for Caldesmon/CALD1 Recombinant Protein (H00000800-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caldesmon/CALD1 Recombinant Protein (H00000800-P01) (0)

There are no reviews for Caldesmon/CALD1 Recombinant Protein (H00000800-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caldesmon/CALD1 Recombinant Protein (H00000800-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caldesmon/CALD1 Products

Bioinformatics Tool for Caldesmon/CALD1 Recombinant Protein (H00000800-P01)

Discover related pathways, diseases and genes to Caldesmon/CALD1 Recombinant Protein (H00000800-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caldesmon/CALD1 Recombinant Protein (H00000800-P01)

Discover more about diseases related to Caldesmon/CALD1 Recombinant Protein (H00000800-P01).
 

Pathways for Caldesmon/CALD1 Recombinant Protein (H00000800-P01)

View related products by pathway.

PTMs for Caldesmon/CALD1 Recombinant Protein (H00000800-P01)

Learn more about PTMs related to Caldesmon/CALD1 Recombinant Protein (H00000800-P01).
 

Research Areas for Caldesmon/CALD1 Recombinant Protein (H00000800-P01)

Find related products by research area.

Blogs on Caldesmon/CALD1

There are no specific blogs for Caldesmon/CALD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caldesmon/CALD1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CALD1
Entrez